Minirosetta 3.20

Message boards : Number crunching : Minirosetta 3.20

To post messages, you must log in.

AuthorMessage
Profile robertmiles

Send message
Joined: 16 Jun 08
Posts: 1264
Credit: 14,422,999
RAC: 65
Message 72128 - Posted: 14 Jan 2012, 20:56:37 UTC

Nobody else has created a thread for the new minirosetta 3.20, so I'm creating one. I've already read that 3.20 is supposed to fix the graphics problem in 3.19.
ID: 72128 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Rocco Moretti

Send message
Joined: 18 May 10
Posts: 66
Credit: 585,745
RAC: 0
Message 72133 - Posted: 14 Jan 2012, 22:11:22 UTC - in response to Message 72128.  

I've already read that 3.20 is supposed to fix the graphics problem in 3.19.


Confirmed - 3.20 should fix the graphics issues seen with 3.19. If you're still encountering problems, please let us know in this thread.
ID: 72133 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Etienne Guyot

Send message
Joined: 27 Oct 05
Posts: 10
Credit: 954,962
RAC: 0
Message 72144 - Posted: 15 Jan 2012, 17:10:51 UTC

Yes !
3.20 has solved the graphics bug.
Thank you very much

Seems that the font in use is not the same as before... Is it ?

Kind regards

Gex - France
ID: 72144 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile [VENETO] boboviz

Send message
Joined: 1 Dec 05
Posts: 2177
Credit: 13,519,023
RAC: 12,599
Message 72148 - Posted: 15 Jan 2012, 19:04:48 UTC

476915389


Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip
Unpacking WU data ...
Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T0586_boinc_cm_test_abinitio_cmiles.boinc.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
Setting up folding (abrelax) ...

ERROR: ERROR: FragmentIO: could not open file aaT0586.9mers
ERROR:: Exit from: ......srccorefragmentFragmentIO.cc line: 233
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

ID: 72148 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Scasc

Send message
Joined: 17 Aug 06
Posts: 2
Credit: 597,247
RAC: 0
Message 72165 - Posted: 17 Jan 2012, 20:49:30 UTC

Confirmed graphic bug fixed by 3.20.
ID: 72165 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
svincent

Send message
Joined: 30 Dec 05
Posts: 219
Credit: 12,120,035
RAC: 0
Message 72178 - Posted: 19 Jan 2012, 17:48:35 UTC

Computation failure with task 476693202 on Mac OS X 10.6

Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

</stderr_txt>
]]>

Similar failures with tasks 476693175, 476692528, 476692356
ID: 72178 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile [VENETO] boboviz

Send message
Joined: 1 Dec 05
Posts: 2177
Credit: 13,519,023
RAC: 12,599
Message 72179 - Posted: 19 Jan 2012, 21:06:13 UTC

477906814


Unpacking WU data ...
Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T6211_nonlocal_boinc_input.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...


Unhandled Exception Detected...

- Unhandled Exception Record -
Reason: Out Of Memory (C++ Exception) (0xe06d7363) at address 0x76B5B9BC

Engaging BOINC Windows Runtime Debugger...
ID: 72179 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
edikl

Send message
Joined: 16 Jun 10
Posts: 10
Credit: 186,187
RAC: 0
Message 72181 - Posted: 19 Jan 2012, 21:32:51 UTC
Last modified: 19 Jan 2012, 21:35:22 UTC

Initialization complete.
Setting WU description ...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

https://boinc.bakerlab.org/rosetta/workunit.php?wuid=435881534
ID: 72181 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
bevjo01

Send message
Joined: 24 Nov 05
Posts: 3
Credit: 130,799
RAC: 0
Message 72200 - Posted: 21 Jan 2012, 16:45:58 UTC

I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20?

I'm participating in several projects including R@H. Sometimes the BOINC client screen saver will present a message during transition to a different project "BOINC has experienced an unknown problem".

Then instead of presenting the R@H screen saver I see a blank screen and two icons on the task bar. One of the icons appears to be "Rosetta-like" but there's nothing to identify it as such.

The other icon is clearly the BOINC client.

The odd thing is that at other times the R@H screen saver presents ok. So I'm wondering if there might be a problem at different phases of processing the WU or something else.

All of the other projects I'm running seem to present ok. I haven't noticed any issues during the transition for anything else.

I'm running Windows 7 Home Professional on a vanilla Intel desktop.

Is there a log file that I can enable for R@H (as opposed to the BOINC Event log) that might help me get better data for you?

JohnB
ID: 72200 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile robertmiles

Send message
Joined: 16 Jun 08
Posts: 1264
Credit: 14,422,999
RAC: 65
Message 72202 - Posted: 21 Jan 2012, 19:43:09 UTC - in response to Message 72200.  

I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20?

I'm participating in several projects including R@H. Sometimes the BOINC client screen saver will present a message during transition to a different project "BOINC has experienced an unknown problem".

Then instead of presenting the R@H screen saver I see a blank screen and two icons on the task bar. One of the icons appears to be "Rosetta-like" but there's nothing to identify it as such.

The other icon is clearly the BOINC client.

The odd thing is that at other times the R@H screen saver presents ok. So I'm wondering if there might be a problem at different phases of processing the WU or something else.

All of the other projects I'm running seem to present ok. I haven't noticed any issues during the transition for anything else.

I'm running Windows 7 Home Professional on a vanilla Intel desktop.

Is there a log file that I can enable for R@H (as opposed to the BOINC Event log) that might help me get better data for you?

JohnB


Under Windows Vista, I have noticed that the 3.20 graphics are slow to start up, but then work properly.
ID: 72202 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Mad_Max

Send message
Joined: 31 Dec 09
Posts: 209
Credit: 30,606,461
RAC: 5,154
Message 72204 - Posted: 23 Jan 2012, 12:40:39 UTC
Last modified: 23 Jan 2012, 12:52:57 UTC

Some of my teammembers get strange logs with multiple(hundreds) entries "attaching viewers!!!!"
For example:
https://boinc.bakerlab.org/rosetta/result.php?resultid=478117036
https://boinc.bakerlab.org/rosetta/result.php?resultid=478119708
https://boinc.bakerlab.org/rosetta/result.php?resultid=478119105

What does this mean? Just not remove some debugging information or is it some sort of errors at work?
ID: 72204 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote

Message boards : Number crunching : Minirosetta 3.20



©2026 University of Washington
https://www.bakerlab.org