Message boards : Number crunching : Rosetta@Home version 3.30
Previous · 1 · 2
| Author | Message |
|---|---|
[VENETO] bobovizSend message Joined: 1 Dec 05 Posts: 2177 Credit: 13,534,942 RAC: 12,034 |
|
|
Tex1954 Send message Joined: 3 Apr 11 Posts: 9 Credit: 3,394,752 RAC: 0 |
I'm seeing about 1 in 50 errors as well. These seemed to error out on the wingmans machine as well. Clearly there is some glitch in the 3.30 workunits... However, about 6 of them were because of me when I tried to increase RAM with mixed G-Skill/Corsair parts and it buggered up long term... Oh well.. I knew I was taking a chance... order more Corsair to do it properly. Many error out now (with ram restored correctly) in the first few minutes or seconds and the wingmans do as well. Soooo, don't think it is really a problem on my system.. Also, FWIW, all my running boxes have GPU's do tasks as well. It's too bad the WU display here doesn't show the normal Error, Pending, Valid selections that most BOINC websites have or it would be a lot easier to figure things out. Still crunching! Seem to be getting fewer errors as I work through the last batch that downloaded.. 8-) |
|
Michael G.R. Send message Joined: 11 Nov 05 Posts: 264 Credit: 11,247,510 RAC: 0 |
Got some system-wide slowdowns, high RAM usage, and a couple computation errors with 3.30. |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Hi. Had this one error today, after 18sec. https://boinc.bakerlab.org/rosetta/workunit.php?wuid=460839382 ab_11_29__optpps_T5311_optpps_03_09_35686_277399_1 <core_client_version>6.10.58</core_client_version> <![CDATA[ <message> process exited with code 1 (0x1, -255) </message> <stderr_txt> Initialization complete. Setting WU description ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> ]]>
|
|
Menace Send message Joined: 4 Nov 05 Posts: 2 Credit: 167,345 RAC: 0 |
Not had any errors, but as these units work through, they fail to upload, so I have 22 units complete but going nowhere. Some seem partially uploaded. A retry sees them upload, but only to the percentage that they had stopped at before, then zilch. This just started to happen by itself, so I'm guessing that all the successfully completed and uploaded WUs were pre-3.30. Any news would be good! Dennis |
|
Mod.Sense Volunteer moderator Send message Joined: 22 Aug 06 Posts: 4018 Credit: 0 RAC: 0 |
Menace, how many K of the file is getting sent up before it ends? It shouldn't reset to zero if anything is actually reaching the upload server. Uploads should not be dependent upon a specific R@h version either. I am just a home user like everyone else, and I've not been seeing any upload problems. Perhaps you have a firewall or other network issue somewhere? Are others having upload problems? Rosetta Moderator: Mod.Sense |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Hi. This is an odd one it ran for 1hr, 30min then erred. Rc015_broker_pairings_50135_4819_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=461221621 ( last part of log ) Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/Rc015_pairings_broker_input.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... BOINC:: Worker startup. Starting watchdog... Watchdog active. # cpu_run_time_pref: 14400 ERROR: impossible to find a valid fold-tree with given sheet-topology and pairings ERROR:: Exit from: src/protocols/jumping/SheetBuilder.cc line: 328 called boinc_finish </stderr_txt> ]]>
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Hi. Is it better to abort tasks i have for mini 3.30, so you get BETTER usable results with the new app. [Quote] May 16, 2012 Rosetta@Home software updated to version 3.31. Addresses issues with improper initialization of inputs in hybrid protocol for comparative modeling. /[quote] I'm just asking after seeing this, specially with CASP running.
|
Message boards :
Number crunching :
Rosetta@Home version 3.30
©2026 University of Washington
https://www.bakerlab.org